Retatrutide – Research Peptide

Price range: £80.00 through £150.00

SKU: N/A Category:

Description

Product Name: Retatrutide

Form: Lyophilized Powder

•⁠ ⁠CAS: 2381089-83-2
•⁠ ⁠Molecular Formula: C₂₂₁H₃₄₂N₄₆O₆₈
•⁠ ⁠Molecular Weight: ~4731.3 g/mol
•⁠ ⁠Purity: ≥99%
•⁠ ⁠Peptide Sequence:
YAQGTFTSDYSILLDKKAQAFIEYLLEGGPSSGAPPPS

Storage & Handling:
– Storage (Lyophilized): Store at -20°C in a dry, desiccated environment.
– After Reconstitution: Store reconstituted peptide at 2–8°C and use within 30 days. For long-term storage, aliquot and freeze at -20°C. Avoid repeated freeze-thaw cycles.
– Reconstitution: Reconstitute in sterile bacteriostatic water or appropriate buffer depending on experimental needs.

This product is sold strictly for in vitro research and laboratory use only. By purchasing or using this product, the buyer agrees they have read, understood and accept the legal policy of Nabz labs.

Additional information

Option

10mg, 20mg, 40mg